| Catalog# |
CJ10 |
| Source |
Human cells |
| Description |
Recombinant mouse CD33 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Asp18-Glu240) of mouse CD33 fused with a polyhistidine tag at the C-terminus. |
| Names |
CD33/Myeloid cell surface antigen CD33/Sialic acid-binding Ig-like lectin 3/Siglec-3/Siglec3 |
| Accession # |
Q63994 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 3X PBS.
Please aliquot the reconstituted solution |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 5 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQ KATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDI IIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTC LVTFSGAGVTVERTIQLNVTRKSGQMREVDHHHHHH*
|
| Background |
Mouse myeloid cell surface antigen CD33(CD33) is a member of the immunoglobulin superfamily and SIGLEC (sialic acid binding Ig-like lectin) family. CD33 contains one Ig-like C2-type domain and one Ig-like V-type domain. CD33 is a putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. CD33 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, CD33 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. CD33 induces apoptosis in acute myeloid leukemia. CD33 is becoming increasingly important as a target of antibody-mediated therapy in acute myeloid leukaemia (AML). |