| Catalog# | 
            CH58 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Peroxiredoxin-1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys199) of Human peroxiredoxin 1 fused with a 6His tag at the N-terminus and C-terminus. | 
        
        
            | Names | 
            Peroxiredoxin-1,Natural killer cell-enhancing factor A,NKEF-A,Proliferation-associated gene protein,PAG,Thioredoxin peroxidase 2,Thioredoxin-dependent peroxide reductase 2,PAGA, PAGB, TDPX2 | 
        
        
            | Accession # | 
            Q06830 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of PBS, 10% glycerol, 0.1mM DTT,pH 6.0. | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/µg (1 IEU/µg). | 
        
        
            | Amino Acid Sequence | 
            
             MGSSHHHHHHSSGLVPRGSHMSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYP LDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKR TIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPA GWKPGSDTIKPDVQKSKEYFSKQKLEHHHHHH* 
             | 
        
        
            | Background | 
            Peroxiredoxin-1(PRDX1) contains 1 thioredoxin domain and belongs to the AhpC/TSA family. PRDX1 constitutively expressed in most human cells and it is induced to higher levels upon serum stimulation in untransformed and transformed cells. PRDX1 is involved in redox regulation of the cell. It reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin and play an important role in eliminating peroxides generated during metabolism. PRDX1 might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. It reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. It may contribute to the antiviral activity of CD8(+) T-cells and have a proliferative effect in cancer development or progression. |