| Catalog# | 
            CH55 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Polyubiquitin-B is produced with our E. coli expression system. The target protein is expressed with sequence (Met153-Gly228) of Human UBB fused with a GST-His-S.tag at the N-terminus. | 
        
        
            | Names | 
            Polyubiquitin-B,UBB | 
        
        
            | Accession # | 
            P0CG47 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/µg (1 IEU/µg). | 
        
        
            | Amino Acid Sequence | 
            
             MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHM DSPDLGTGGGSGDDDDKSPMGYRGSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG* 
             | 
        
        
            | Background | 
            Polyubiquitin-B contains 3 ubiquitin-like domains, which belongs to the ubiquitin family. Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair; Lys-11-linked is involved in ERAD and cell-cycle regulation; Lys-29-linked is involved in lysosomal degradation; Lys-33-linked is involved in kinase modification; Lys-48-linked is part in protein degradation via the proteasome; Lys-63-linked is involved in endocytosis, DNA-damage responses as well as in signaling processes leading to activation of the transcription factor NF-kappa-B. Linear polymer chains formed via attachment by the initiator Met lead to cell signaling. Ubiquitin is usually conjugated to Lys residues of target proteins, however, in rare cases, conjugation to Cys or Ser residues has been observed. When polyubiquitin is free (unanchored-polyubiquitin), it also has distinct roles, such as in activation of protein kinases, and in signaling. |