| Catalog# |
CJ18 |
| Source |
Human cells |
| Description |
Recombinant Human SPINK7 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Cys85) of Human SPINK7 fused with a polyhistidine tag at the C-terminus. |
| Names |
SPINK7/ECRG-2/Esophagus cancer-related gene 2 protein/Serine protease inhibitor Kazal-type 7/ECG2 |
| Accession # |
P58062 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGS CVDHHHHHH*
|
| Background |
Serine protease inhibitor Kazal-type 7(SPINK7) is a secreted protein, that in humans is encoded by the SPINK7 gene. SPINK7 contains 1 Kazal-like domain. SPINK7 is probably serine protease inhibitor. Recombinant human SPINK7 is a single, non-glycosylated polypeptide chain containing 74 amino acids and fused to His-tag at c-terminus. |
