| Catalog# |
CA76 |
| Source |
Human Cells |
| Description |
Recombinant Human Activin Receptor Type-1/ACVR1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met21-Val124) of Human ACVR1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Activin Receptor Type-1, Activin Receptor Type I, ACTR-I, Activin Receptor-Like Kinase 2, ALK-2, Serine/Threonine-Protein Kinase Receptor R1, SKR1, TGF-B Superfamily Receptor Type I, TSR-I, ACVR1, ACVRLK2 |
| Accession # |
Q04771 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPP SPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVVDHHHHHH
|
| Background |
Activin receptor type-1, also known as Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACVRLK2 and ACVR1, is a single-pass type I membrane protein. ACVR1 is expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. ACVR1 belongs to the protein kinase superfamily. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 signals a particular transcriptional response in concert with activin type II receptors. |
