| Catalog# |
C422 |
| Source |
HEK293 |
| Description |
Recombinant Human Activin Receptor-Like Kinase 1/ALK-1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Asp22-Gln118) of Human ACVRL1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Serine/Threonine-Protein Kinase Receptor R3, SKR3, Activin Receptor-Like Kinase 1, ALK-1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRL1, ACVRLK1, ALK1 |
| Accession # |
P37023 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVN HYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQVDHHHHHH
|
| Background |
Activin Receptor-Like Kinase 1 (ALK-1) is a type I cell-surface receptor for the TGF-βsuperfamily of ligands. ALK-1 has a high degree of similarity in serine-threonine kinase subdomains, a glycine and serine rich region preceding the kinase-domain, and a C-terminal tail with other activin receptor-like kinase proteins. The mutations of ALK-1 are associated with Rendu-Osler-Weber syndrome 2, this suggests ACVRL1 is associated with blood vessel development and repair |
