| Catalog# |
C208 |
| Source |
E.coli |
| Description |
Recombinant Human Annexin A7/ANXA7 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Gln466) of Human ANXA7. |
| Names |
Annexin A7, Annexin VII, Annexin-7, Synexin, ANXA7, ANX7, SNX |
| Accession # |
P20073 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 10mM Tris-HCl, 100mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGG YPAPGGYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQ MPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSN DQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIE ILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQ RLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQ CALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGD YRRLLLAIVGQ
|
| Background |
Annexin A7 (ANXA7) is a member of the annexin family of calcium-dependent phospholipid binding proteins. Annexin A7 has a unique, highly hydrophobic N-terminal domain and a conserved C-terminal region. The C-terminal region is composed of alternating hydrophobic and hydrophilic segments. Annexin A7 is a calcium/phospholipid-binding protein with diverse properties including voltage-sensitive calcium channel activity and promotes membrane fusion and is also involved in exocytosis. |
