| Catalog# |
CA19 |
| Source |
HEK293 |
| Description |
Recombinant Human Fibroblast Growth Factor 23/FGF-23 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr25-Ile251) of Human FGF23 fused with a 6His tag at the C-terminus. |
| Names |
Fibroblast Growth Factor 23, FGF-23, Phosphatonin, Tumor-Derived Hypophosphatemia-Inducing Factor, FGF23, HYPF |
| Accession # |
Q9GZV9 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVM SRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPY SQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPM ASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIVDHHHHHH
|
| Background |
Fibroblast Growth Factor 23 (FGF-23) is a secreted protein that belongs to the heparin-binding growth factors family. FGF-23 is expressed in osteogenic cells, particularly during phases of active bone remodeling. FGF family members possess broad mitogenic and cell survival activities, involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF-23 regulates homeostasis of phosphate and vitamin-D metabolism. FGF-23 inhibits renal tubular phosphate transport by reducing SLC34A1 levels, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 also upregulates EGR1 expression in the presence of KL, acts directly on the parathyroid to decrease PTH secretion. Defects in FGF-23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR). |
