| Catalog# | 
            C198 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Fibroblast Growth Factor 9/FGF-9 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ser208) of Human FGF-9. | 
        
        
            | Names | 
            Fibroblast Growth Factor 9, FGF-9, Glia-Activating Factor, GAF, Heparin-Binding Growth Factor 9, HBGF-9, FGF9 | 
        
        
            | Accession # | 
            P31371 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/µg (1 IEU/µg). | 
        
        
            | Amino Acid Sequence | 
            
             MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQ LYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKL TQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPD KVPELYKDILSQS 
             | 
        
        
            | Background | 
            Fibroblast Growth Factor 9 (FGF-9) belongs to the Fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In addition, FGF-9 may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. |