| Catalog# |
C346 |
| Source |
HEK293 |
| Description |
Recombinant Human Fibroblast Growth Factor-Binding Protein 1/FGF-BP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (K24-C234) of Human FGFBP1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Fibroblast Growth Factor-Binding Protein 1, FGF-BP, FGF-BP1, FGF-Binding Protein 1, FGFBP-1, 17 kDa Heparin-Binding Growth Factor-Binding Protein, 17 kDa HBGF-Binding Protein, HBp17, FGFBP1, FGFBP, HBP17 |
| Accession # |
Q14512 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
KKKVKNGLHSKVVSEQKDTLGNTQIKQKSRPGNKGKFVTKDQANCRWAATEQEEGISLKVECTQL DHEFSCVFAGNPTSCLKLKDERVYWKQVARNLRSQKDICRYSKTAVKTRVCRKDFPESSLKLVSS TLFGNTKPRKEKTEMSPREHIKGKETTPSSLAVTQTMATKAPECVEDPDMANQRKTALEFCGETW SSLCTFFLSIVQDTSCVDHHHHHH
|
