| Catalog# |
C608 |
| Source |
HEK293 |
| Description |
Recombinant Human Fibroblast Growth Factor-Binding Protein 2/FGF-BP2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln20-Gly223) of Human FGFBP2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Fibroblast Growth Factor-Binding Protein 2, FGF-BP2, FGF-Binding Protein 2, FGFBP-2, 37 kDa Killer-Specific Secretory Protein, Ksp37, HBp17-Related Protein, HBp17-RP, FGFBP2, KSP37 |
| Accession # |
Q9BYJ0 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAF AADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPS LRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALC AFLISFFRGLDHHHHHH
|
| Background |
Fibroblast Growth Factor-Binding Protein 2 (FGF-BP2) is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. It is produced by NK cells, γ/δ T-cells, a subset of effector CD8 T cells and Th1 cells, and secreted to serum. Most FGF-BP2 expressing cells co-express perforin, which suggests that FGF-BP2 may be involved in an essential process of cytotoxic lymphocyte-mediated immunity. Elevated FGF-BP2 levels in body fluids has been found in asthma and some infectious disease patients. |
