| Catalog# |
CH38 |
| Source |
E. coli |
| Description |
Recombinant Human Fibronectin fragment/RetroNectin is produced with our E. coli expression system.The target protein is expressed with sequence (Pro1270-Ser1546&Ala1721-Thr2016) of Human Fibronectin. |
| Names |
Fibronectin, Retronectin, CIG, FN, Cold-insoluble globulin |
| Accession # |
P02751 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.01 ng/µg (0.1 IEU/µg). |
| Amino Acid Sequence |
MPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTE YVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFS GRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTS LLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSP ASSKPISINYRTEIDKPSMAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMK EINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTIT ISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVV IDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST
|
| Background |
'Fibronectin1(FN1) is a secreted protein and contains 12 fibronectin type-I domains, fibronectin type-II domains and 16 fibronectin type-III domains.Recombinant human fibronectin fragment, is a protein of 63 kDa containing a central cell-binding domain (type III repeat, 8, 9, 10), a high affinity heparin-binding domain II (type III repeat, 12, 13, 14), and CS1 site within the alternatively spliced III CS region of human fibronectin. Cells bind to a VLA-4 ligand, a CS-I site, and a VLA-5 ligand, a cell attachment domain, and virus vectors binds to a heparin binding domain II, which co-locates the cell and the virus vector on RetroNectin.' |
