| Catalog# |
CH60 |
| Source |
E.coli |
| Description |
Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asp224) of Human FKBP3/FKBP25 fused with a 6His tag at the N-terminus.. |
| Names |
Peptidyl-prolyl cis-trans isomerase FKBP3,PPIase FKBP3,25 kDa FK506-binding protein,25 kDa FKBP,FKBP-25,FK506-binding protein 3,FKBP-3,Immunophilin FKBP25,Rapamycin-selective 25 kDa immunophilin,Rotamase,FKBP25 |
| Accession # |
Q00688 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl，1mM DTT,10%glycerol, pH8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLG NIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPK YTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGW DEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
|
| Background |
FKBP3 contains 1 PPIase FKBP-type domain, belongs to the FKBP-type PPIase family. FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. FKBP3 is a cis-trans prolyl isomerase enzyme that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. |
