| Catalog# | 
            CA33 | 
        
        
            | Source | 
            HEK293 | 
        
        
            | Description | 
            Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Leu222) of Human FKBP7 fused with a 6His tag at the C-terminus. | 
        
        
            | Names | 
            Peptidyl-Prolyl Cis-Trans Isomerase FKBP7, PPIase FKBP7, 23 kDa FK506-Binding Protein, 23 kDa FKBP, FKBP-23, FK506-Binding Protein 7, FKBP-7, Rotamase, FKBP7, FKBP23 | 
        
        
            | Accession # | 
            Q9Y680 | 
        
        
            | Formulation | 
            Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5 | 
        
        
            | Shipping | 
            The product is shipped on dry ice/ice packs. | 
        
        
            | Storage | 
            Store at < -20°C, stable for 6 months after receipt. 
            Please minimize freeze-thaw cycles. | 
        
        
            | Purity | 
            Greater than 95% as determined by reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/µg (1 IEU/µg). | 
        
        
            | Amino Acid Sequence | 
            
             QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLG VGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIET FKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQ HDELVDHHHHHH 
             | 
        
        
            | Background | 
            Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 (FKBP7) is a member of the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. FKBP7 exhibits PPIase activity and function as molecular chaperones. In addition, FKBP7 accelerates the folding of proteins during protein synthesis. It has been shown that Hsp90 complex to the nucleus bind its PPIase domain to cytoplasmic dynein, the motor protein responsible for retrograde movement along microtubules. |