| Catalog# |
C970 |
| Source |
HEK293 |
| Description |
Recombinant Human Leucine-Rich Repeat Transmembrane Protein FLRT3/FLRT3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys29-Pro528) of Human FLRT3 fused with a polyhistidine tag at the C-terminus. |
| Names |
Leucine-Rich Repeat Transmembrane Protein FLRT3, Fibronectin-Like Domain-Containing Leucine-Rich Transmembrane Protein 3, FLRT3, KIAA1469 |
| Accession # |
Q9NZU0 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
KSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPSDLKNLLKVERIYLYHN SLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRL LFLSRNHLSTIPWGLPRTIEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFN LVNLTELSLVRNSLTAAPVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQ GIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELF DCKDSGIVSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSV TSDTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMVPME TSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPVDHHHHHH
|
| Background |
Leucine-Rich Repeat Transmembrane Protein FLRT3 (FLRT3) is a member of the fibronectin leucine rich transmembrane protein (FLRT) family. Proteins in this family play an role in cell adhesion and/or receptor signalling. FLRT3 is a single-pass type I membrane protein and contains one fibronectin type-III domain, ten LRR (leucine-rich) repeats, one LRRCT domain, and one LRRNT domain. FLRT3 may have a function in cell adhesion and/or receptor signaling. FLRT3 may regulate cellular adhesion between the epithelial apical ridge and the underlying mesenchyme and in establishing the dorso-ventral position of the ridge. |
