| Catalog# |
C413 |
| Source |
HEK293 |
| Description |
Recombinant Human Frizzled-7/FZD7 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln33-Leu185) of Human Frizzled-7 fused with a polyhistidine tag at the C-terminus. |
| Names |
Frizzled-7, Fz-7, hFz7, FzE3, FZD7 |
| Accession # |
O75084 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPE LRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVG QNTSDGSGGPGGGPTAYPTAPYLVDHHHHHH
|
| Background |
Frizzled-7 is a member of the Frizzled family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway; it leads to the activation of disheveled proteins, nuclear accumulation of beta-catenin, inhibition of GSK-3 kinase and activation of Wnt target genes. Frizzled-7 is an unconventional G-protein-coupled glycoprotein receptors for Wnt proteins. Frizzled-7 contains a divergent N-terminal signal peptide, a conserved cysteine-rich domain, a variable-length linker region, a seven-pass transmembrane region, and a variable-length C-terminal cytoplasmic domain. Frizzled-7 is expressed in skeletal muscle to mediate muscle regeneration in response to Wnt-7a. It also expressed in embryonic stem cells, contributing to self-renewal signaling. |
