| Catalog# | 
            CE37 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Growth Arrest and DNA Damage-Inducible Protein GADD45 β/GADD45B produced by E. coli expression system. The target protein is expressed with sequence (Met1-Arg160) of Human GADD45B fused with a 6His tag at the N-terminus. | 
        
        
            | Names | 
            Growth Arrest and DNA Damage-Inducible Protein GADD45 Beta, Myeloid Differentiation Primary Response Protein MyD118, Negative Growth Regulatory Protein MyD118, GADD45B, MYD118 | 
        
        
            | Accession # | 
            O75293 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             MGSSHHHHHHSSGLVPRGSHMTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAK LMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQG TTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER 
             | 
        
        
            | Background | 
            Growth Arrest and DNA Damage-Inducible Protein GADD45 β (GADD45B) is a member of the GADD45 family. GADD45B has been shown to interact with MAP3K4, ASK1, MAP2K7, and GADD45GIP1. GADD45B is involved in the regulation of growth and apoptosis. GADD45B reacts to environmental stresses by mediating activation of stress-responsive MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. In addition, GADD45B participates in the down-regulation of hepatocellular carcinoma (HCC). It may serve as a possible therapeutic target. |