| Catalog# | 
            CE38 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Galactokinase/GALK1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu392) of Human GALK1 fused with a 6His tag at the C-terminus. | 
        
        
            | Names | 
            Galactokinase, Galactose Kinase, GALK1, GALK | 
        
        
            | Accession # | 
            P51570 | 
        
        
            | Formulation | 
            Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 | 
        
        
            | Shipping | 
            The product is shipped on dry ice/ice packs. | 
        
        
            | Storage | 
            Store at < -20°C, stable for 6 months after receipt. 
            Please minimize freeze-thaw cycles. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVG SPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVV SSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQK GHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQL EELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPEL DQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVL CLLEHHHHHH 
             | 
        
        
            | Background | 
            Galactokinase belongs to the GHMP kinase family and GalK subfamily. Galactokinase is more important to the galactose metabolism pathway. It modifies galactose to create a similar molecule called Galactose-1-Phosphate.Thus, a series of additional steps converts Galactose-1-Phosphate to another simple sugar Glucose, which is the main energy source for most cells. Galactokinase deficiency results in Galactosemia II, an autosomal recessive deficiency characterized by congenital cataracts during infancy and presenile cataracts in the adult population. The cataracts are secondary to accumulation of Galactitol in the lenses. |