| Catalog# |
C285 |
| Source |
E.coli |
| Description |
Recombinant Human Galectin-1 is produced by our E. coli expression system. The target protein is expressed with sequence (Ala2-Asp135) of Human LGALS1 fused with a 6His tag at the C-terminus. |
| Names |
Galectin-1, Gal-1, 14 kDa Laminin-Binding Protein, HLBP14, 14 kDa Lectin, Beta-Galactoside-Binding Lectin L-14-I, Galaptin, HBL, HPL, Lactose-Binding Lectin 1, Lectin Galactoside-Binding Soluble 1, Putative MAPK-Activating Protein PM12, S-Lac Lectin 1, LG |
| Accession # |
P09382 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 10mM PB, 200mM NaCl, 2mM DTT, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
Measured by its ability to agglutinate human red blood cells. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKD GGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK CVAFDLEHHHHHH
|
| Background |
Galectin-1 is a member of growing family of evolutionary conserved animal lectins. Galectin-1 is widely expressed in many cells and tissues. Galectins consists of a Galectin domain and two Beta-galactoside binding domains. Galectin-1 can binds LGALS3BP and interacts with CD2, CD3, CD4, CD7, CD43 and CD45. Galectin-1 may act as an autocrine negative growth factor which regulates apoptosis, cell proliferation and cell differentiation. In addition, Galectin-1 plays improtant roles in immunosuppressive and antiinflammatory properties. |
