| Catalog# |
C225 |
| Source |
E.coli |
| Description |
Recombinant Human Growth Arrest-Specific Protein 7/GAS-7 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile412) of Human GAS7 fused with a His tag at the N-terminus. |
| Names |
Growth Arrest-Specific Protein 7, GAS-7, GAS7, KIAA0394 |
| Accession # |
O60861 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.8 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPS SSPGIPASPGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTI TINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSE FIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPL MNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDI KKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIRQHLCQYTQLRHETD MFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI
|
| Background |
Growth Arrest-Specific Protein 7 (GAS7) is expressed primarily in terminalaly differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 may play a role in neuronal development by promoting maturation and morphological differentiation of cerebellar neurons. Inhibition of GAS7 production in terminally differentiating cultures of embryonic murine cerebullum impedes neurite outgrowth. The hyper-expression of GAS7 may play an major role in the initiation and development of huaman osteosarcoma. |
