| Catalog# |
C472 |
| Source |
HEK293 |
| Description |
Recombinant Human GDNF Family Receptor α-2/GFRA2 produced by transfected human cells is a secreted protein with sequence (Ser22-Ser441) of Human GFRA2 fused with a polyhistidine tag at the C-terminus. |
| Names |
GDNF Family Receptor Alpha-2, GDNF Receptor Alpha-2, GDNFR-Alpha-2, GFR-Alpha-2, GDNF Receptor Beta, GDNFR-Beta, Neurturin Receptor Alpha, NRTNR-Alpha, NTNR-Alpha, RET Ligand 2, TGF-Beta-Related Neurotrophic Factor Receptor 2, GFRA2, GDNFRB, RETL2, TRNR2 |
| Accession # |
O00451 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQ ESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGAD PVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYT YRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQT VTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENP CLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK ANNSKELSMCFTELTTNIIPGSNKVIKPNSVDHHHHHH
|
| Background |
Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and Neurturin, play key roles in the control of vertebrate neuronal survivial and differentiation. GDNF is a glycosylated, disulfide-bonded homodimer that is distantly related to the TGF superfamily of growth factors. Three receptors for these factors, GFRα-1, GFRα-2, and GFRα-3 have been identified. The receptors do not contain transmembrane domains and are attached to the cell membrane by glycosyl-phosphoinositol linkage. Both GFRα-1 and GFRα-2 have been shown to mediate the GDNF-dependent and Neurturin-dependent phosphorylation and activation of the tyrosine kinase Ret. GFR-3 is expressed only during development. GFRα-2 binds Neurturin and mediates activation of RET receptor tyrosine kinase by both Neurturin and GDNF. |
