| Catalog# | 
            C474 | 
        
        
            | Source | 
            HEK293 | 
        
        
            | Description | 
            Recombinant Human Glycoprotein A33/GPA33 produced by transfected human cells is a secreted protein with sequence (Ile22-Val235) of Human GPA33 fused with a polyhistidine tag at the C-terminus. | 
        
        
            | Names | 
            Cell Surface A33 Antigen, Glycoprotein A33, GPA33 | 
        
        
            | Accession # | 
            Q99795 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYK NRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGE TIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNE EGTQFCNITVAVRSPSMNVVDHHHHHH 
             | 
        
        
            | Background | 
            Human Glycoprotein A33 (GPA33) is a single-pass type I membrane protein, belongs to the CTX family of cell adhesion molecular within the immunoglobulin family, can be expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 consists of one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, a extracellular region and a intracellular tail. Intracellular traffic and recycling to the cell surface appear to play an important role in GPA33 function and to have an influence on its surface density superseding translation regulation. GPA33 has become a promising target of immunologic therapy strategies. GPA33 may also play a important role in cell-cell recognition and signaling. |