| Catalog# |
C867 |
| Source |
Human Cells |
| Description |
Recombinant Human GMP Reductase 1/GMPR is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ser345) of Human GMPR fused with a polyhistidine tag at the C-terminus. |
| Names |
GMP Reductase 1, Guanosine 5'-Monophosphate Oxidoreductase 1, Guanosine Monophosphate Reductase 1, GMPR, GMPR1 |
| Accession # |
P36959 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,pH8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT FEM AAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV PQVKFI CLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV GPGSVCTTR TKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM LGGMFSGHTECA GEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD VENTILDILGGLRST CTYVGAAKLKELSRRATFIRVTQQHNTVFSVDHHHHHH
|
| Background |
GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known. |
