| Catalog# |
C658 |
| Source |
HEK293 |
| Description |
Recombinant Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1/GPIHBP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Ser160) of Human GPIHBP1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1, GPI-HBP1, GPI-Anchored HDL-Binding Protein 1, High Density Lipoprotein-Binding Protein 1, GPIHBP1, HBP1 |
| Accession # |
Q8IV16 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSH GQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSVDHHHHHH
|
| Background |
Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1 (GPIHBP1) is a single-pass membrane protein that contains one UPAR/Ly6 domain. GPIHBP1 is localized to the cell surface. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons. GPIHBP1 plays a key role in the lipolytic processing of chylomicrons. |
