| Catalog# |
C195 |
| Source |
E.coli |
| Description |
Recombinant Human Grancalcin/GCA is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ile217) of Human GCA. |
| Names |
Grancalcin, GCA, GCL |
| Accession # |
P28676 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 1mM EDTA, pH 8.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
IN STOCK |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQD GEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMT VDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVACCVKLRALTDFFRKR DHLQQGSANFIYDDFLQGTMAI
|
| Background |
Grancalcin (GCA) is a cytoplasmic granule membrane protein that contains 4 EF-hand domains. GCA is calcium-binding protein and particularly abundant in human neutrophils. GCA is highly expressed in bone marrow, and it can be detected in neutrophils and macrophages. Calcium-binding protein GCA cooperates with SRI and LCP1, so it may play a role in the adhesion of neutrophils to fibronectin. GCA also may play a role in the formation of focal adhesions. |
