| Catalog# |
C355 |
| Source |
HEK293 |
| Description |
Recombinant Human Granzyme A is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Glu27-Val262) of Human GZMA fused with a polyhistidine tag at the C-terminus. |
| Names |
Granzyme A, CTL Tryptase, Cytotoxic T-Lymphocyte Proteinase 1, Fragmentin-1, Granzyme-1, Hanukkah Factor, H Factor, HF, GZMA, CTLA3, HFSP |
| Accession # |
P12544 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
EKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPT KQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRT HNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGV FRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVVDHHHHHH
|
| Background |
Granzyme A is a member of the Franzyme family. Granzyme A is the most abundant Serine Protease in Cytotoxic T Lymphocytes (CTL) and Natural Killer (NK) cells. Granzyme A has a specifically function in CTL and NK cells. It induces caspase-independent cell death when introduced into target cells by perforin. Human Granzyme A is synthesized as a precursor (262 residues) with a signal peptide (residues 1-26), a propeptide (residues 27-28) and a mature chain (residues 29-262). |
