| Catalog# |
C230 |
| Source |
E.coli |
| Description |
Recombinant Human U6 snRNA-Associated Sm-Like Protein LSm4/LSM4 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Gln139) of Human LSM4 fused with a His tag at the N-terminus. |
| Names |
U6 snRNA-Associated Sm-Like Protein LSm4, Glycine-Rich Protein, GRP, LSM4 |
| Accession # |
Q9Y4Z0 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 1mM DTT, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVIC TSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRG VFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
|
| Background |
U6 snRNA-associated Sm-like protein LSm4 (LSM4) is a member of the snRNP Sm proteins family. Sm-like proteins contain the Sm sequence motif and are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. LSM4 forms a heteromer with a donut shape. The complexes are involved in various steps of RNA metabolism. LSM4 binds specifically to the 3-terminal U-tract of U6 snRNA. LSM4 contributes RNA protein interactions and structural changes which are essential during ribosomal subunit assembly. |
