| Catalog# | 
            C613 | 
        
        
            | Source | 
            HEK293 | 
        
        
            | Description | 
            Recombinant Human Hyaluronan and Proteoglycan Link Protein 1/HAPLN1 is produced with our mammalian cell expression system in human cells. The target protein is expressed with sequence (Asp16-Asn354) of Human HAPLN1 fused with a polyhistidine tag at the C-terminus. | 
        
        
            | Names | 
            Hyaluronan and Proteoglycan Link Protein 1, Cartilage-Linking Protein 1, Cartilage-Link Protein, Proteoglycan Link Protein, HAPLN1, CRTL1 | 
        
        
            | Accession # | 
            P10915 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIK WTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGL EDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWL SDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEA VQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDK KHKLYGVYCFRAYNVDHHHHHH 
             | 
        
        
            | Background | 
            Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1) is a secreted protein that belongs to the HAPLN family. HAPLN1 is synthetized as a 354 amino acid precursor containing a 15 amino acid signal sequence and a 339 amino acid mature region. It contains one Ig-like V-type (immunoglobulin-like) domain and two Link domains. The Ig domain of HAPLN1 binds to Aggrecan, while the two link modules of HAPLN1 bind to Hyaluronic Acid (HA). HAPLN1 is widely expressed in many tissues; however it is weakly expressed in the brain. HAPLN1 contributes to the stability and flexibility of the extracellular matrix by stabilizing the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix. |