| Catalog# |
C231 |
| Source |
E.coli |
| Description |
Recombinant Human Hemoglobin Subunit Zeta/HBAZ is produced by our E. coli expression system. The target protein is expressed with sequence (Ser2-Arg142) of Human HBZ fused with a His tag at the N-terminus. |
| Names |
Hemoglobin Subunit Zeta, HBAZ, Hemoglobin Zeta Chain, Zeta-Globin, HBZ, HBZ2 |
| Accession # |
P02008 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 100mM NaCl, 2mM DTT, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFP HFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTL AARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
|
| Background |
Hemoglobin Subunit Zeta (HBZ) is a member of the Globin family. The zeta chain is an alpha-type chain of mammalian embryonic Hemoglobin that is synthesized primarily in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal growth and adult life. The HBZ gene consists of five functional genes and two pseudogenes, the order of genes is 5-zeta-pseudozeta-mu-pseudoalpha-1-alpha-2-alpha-1-theta-1-3. |
