| Catalog# |
C274 |
| Source |
E.coli |
| Description |
Recombinant Human Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 2/HDHD2 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Leu259) of Human HDHD2 fused with a 6His tag at the N-terminus. |
| Names |
Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 2, HDHD2 |
| Accession # |
Q9H0R4 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 50mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFV TNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDP NAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKAT VVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPP YLTCESFPHAVDHILQHLL
|
| Background |
Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 22 (HDHD2) is a member of the HAD-like hydrolase superfamily. HDHD2 includes L-2-Haloacid Dehalogenase, Epoxide Hydrolases and Phosphatases. There are two active sites in HDHD2 - an L-2-Haloacid Dehalogenase and a Carboxylate group. The L-2-Haloacid Dehalogenase active site catalyzes the hydrolytic dehalogenation of D- and L-2-Haloalkanoic Acids, producing L- and D-2-Hydroxyalkanoic Acids. |
