| Catalog# | 
            CA74 | 
        
        
            | Source | 
            HEK293 | 
        
        
            | Description | 
            Recombinant Human HLA Class II Histocompatibility Antigen DR β 5 Chain/HLA-DRB5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly30-Lys227) of Human HLA-DRB5 fused with a polyhistidine tag at the C-terminus. | 
        
        
            | Names | 
            HLA Class II Histocompatibility Antigen DR Beta 5 Chain, DR Beta-5, DR2-Beta-2, Dw2, MHC Class II Antigen DRB5, HLA-DRB5 | 
        
        
            | Accession # | 
            Q30154 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Storage | 
            Store at < -20°C, stable for 6 months after receipt. 
            Please minimize freeze-thaw cycles. | 
        
        
            | Purity | 
            Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             GDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAVTELGRPDAEYWNSQK DFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFYPGSIEVR WFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESA QSKVDHHHHHH 
             | 
        
        
            | Background | 
            HLA Class II Histocompatibility Antigen DR β 5 Chain (HLA-DRB5) is a single-pass type I membrane protein that belongs to the MHC class II family. HLA-DRB5 contains one Ig-like C1-type domain. The class II molecule is a heterodimer consisting of an α (DRA) and a β chain (DRB), both anchored in the membrane. HLA-DRB5 plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. Within the DR molecule, the β chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. The presence of DRB5 is linked with allelic variants of DRB1, otherwise it is omitted. |