| Catalog# |
C232 |
| Source |
E.coli |
| Description |
Recombinant Human Hippocalcin-Like Protein 1/HPCAL1 is produced by our E. coli expression system. The target protein is expressed with sequence (Gly2-Phe193) of Human HPCAL1 fused with a His tag at the N-terminus. |
| Names |
Hippocalcin-Like Protein 1, Calcium-Binding Protein BDR-1, HLP2, Visinin-Like Protein 3, VILIP-3, HPCAL1, BDR1 |
| Accession # |
P37235 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 200mM NaCl, 1mM DTT, 10% Glycerol, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTV DEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDL DGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKS DPSIVRLLQCDPSSASQF
|
| Background |
Hippocalcin-Like Protein 1 (HPCAL1) is a neuron-specific calcium-binding member of the recoverin family which found in the retina and brain. HPCAL1 contains four EF-hand domains and it is highly similar to human hippocalcin protein. HPCAL1 is involved in the calcium-dependent regulation of rhodopsin phosphorylation. In addition, it may be of relevance for neuronal signalling in the central nervous system. |
