| Catalog# |
C357 |
| Source |
HEK293 |
| Description |
Recombinant Human High Mobility Group Protein B1/HMGB1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (G2-E215) of Human HMBG1 fused with a polyhistidine tag at the C-terminus. |
| Names |
High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMGB1, HMG1 |
| Accession # |
P09429 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAK ADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLG EMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEE DEEEEEDEEDEDEEEDDDDEVDHHHHHH
|
| Background |
High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses. |
