| Catalog# | 
            CE50 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human 4-Hydroxyphenylpyruvate Dioxygenase/4HPPD is produced with our E. coli expression system. The target protein is expressed with sequence (Thr2-Met393) of Human HPD fused with a 6His tag at the N-terminus. | 
        
        
            | Names | 
            4-Hydroxyphenylpyruvate Dioxygenase, 4-Hydroxyphenylpyruvic Acid Oxidase, 4HPPD, HPD, HPPDase, HPD, PPD | 
        
        
            | Accession # | 
            P32754 | 
        
        
            | Formulation | 
            Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 50mM NaCl, 1mM DTT, 0.1mM PMSF, pH 8.0 | 
        
        
            | Shipping | 
            The product is shipped on dry ice/ice packs. | 
        
        
            | Storage | 
            Store at < -20°C, stable for 6 months after receipt. 
            Please minimize freeze-thaw cycles. | 
        
        
            | Purity | 
            Greater than 95% as determined by reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             MGSSHHHHHHSSGLVPRGSHMTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPL AYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKA RERGAKIMREPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPK CSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI NEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKT AKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKA FEEEQNLRGNLTNMETNGVVPGM 
             | 
        
        
            | Background | 
            4-Hydroxyphenylpyruvate Dioxygenase (4HPPD) belongs to the 4HPPD family. 4HPPD is a key enzyme in the degradation of tyrosine, which catalyzes the second reaction in the catabolism of tyrosine the conversation of 4-hydroxyphenylpyruvate to homogentisate. 4HPPD exists in homodimer forms, which uses zinc as a cofactor to catalyze the third step in the conversion of L-phenylalanine to fumarate and acetoacetic acid. When the active 4HPPD enzyme concentration is low in the human body, it results in high levels of tyrosine concentration in the blood, which can cause mild mental retardation at birth, and degradation in vision as a patient grows older. |