| Catalog# |
C418 |
| Source |
HEK293 |
| Description |
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 14/TNFRSF14 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Leu39-Val202) of Human TNFRSF14 fused with a polyhistidine tag at the C-terminus. |
| Names |
Tumor Necrosis Factor Receptor Superfamily Member 14, Herpes Virus Entry Mediator A, Herpesvirus Entry Mediator A, HveA, Tumor Necrosis Factor Receptor-Like 2, TR2, CD270, TNFRSF14, HVEA, HVEM |
| Accession # |
Q92956 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAM GLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPG TFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVVDHHHHHH
|
