| Catalog# |
CC75 |
| Source |
HEK293 |
| Description |
Recombinant Human Interferon alpha-1/13 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys24-Glu189) of Human IFNA1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Interferon alpha-1/13(IFN-alpha-1/13 for short), also known as Interferon alpha-D, is a secreted protein which belongs to the alpha/beta interferon family. |
| Accession # |
P01562 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIF NLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLY LTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEVDHHHHHH
|
| Background |
Interferon alpha-1/13(IFN-alpha-1/13 for short), also known as Interferon alpha-D, is a secreted protein which belongs to the alpha/beta interferon family. It is produced by macrophages. IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha exerts a variety of other biological effects, including antitumor and immunomodulatory activities and are increasingly used clinically to treat a range of malignancies, myelodysplasias and autoimmune diseases. |
