Catalog# |
C916 |
Source |
Human Cells |
Description |
Recombinant Human Netrin-G1/NTNG1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His29-Ser409) of Human Netrin-G1 fused with a polyhistidine tag at the C-terminus. |
Names |
Netrin-G1, Laminet-1, NTNG1, KIAA0976, LMNT1 |
Accession # |
Q9Y2I2 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
Amino Acid Sequence |
HYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDPPETFCAMGNPYMCNNECD ASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPD QMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHF EIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAI SDIKVRGRCKCNLHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANT CIPSISSIGTNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSVDHHHHHH
|
Background |
Netrin-G1 (NTNG1) is a member of a conserved family of proteins that act as axon guidance cues during vertebrate nervous system development. Netrin-G1 contains one laminin EGF-like domain and one laminin N-terminal domain, Netrin-G1 is highly expressed in the thalamus, lowly in other tissue. Netrin-G1 localizes to the cell membrane. Netrin-G1 interacts with NGL1 and is glycosylated in the N-terminal. In addition, Netrin-G1 can promotesneurite outgrowth of both axons and dendrites. |