| Catalog# |
CA51 |
| Source |
HEK293 |
| Description |
Recombinant Human Prostaglandin-H2 D-Isomerase/PTGDS is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala23-Gln190) of Human PTGDS fused with a polyhistidine tag at the C-terminus. |
| Names |
Prostaglandin-H2 D-Isomerase, Beta-Trace Protein, Cerebrin-28, Glutathione-Independent PGD Synthase, Lipocalin-Type Prostaglandin-D Synthase, Prostaglandin-D2 Synthase, PGD2 Synthase,PGDS, PGDS2, PTGDS, PDS |
| Accession # |
P41222 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKN QCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRT QTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQVDHHHHHH
|
| Background |
Prostaglandin-H2 D-Isomerase (PTGDS) belongs to the Lipocalin family of calycin superfamily. PTGDS is preferentially expressed in the brain. PTGDS catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. PTGDS is involved in a variety of CNS functions, such as sedation, REM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. PTGDS binds small non-substrate lipophilic molecules and may act as a scavenger for harmful hydrophopic molecules and a secretory retinoid and thyroid hormone transporter. It possibly participates in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor, blood-testis barrier, the central nervous system and male reproductive system. |
