| Catalog# |
C218 |
| Source |
E.coli |
| Description |
Recombinant Human Cytoplasmic Dynein Light Chain 1/DYNLL1 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Gly89) of Human DYNLL1 fused with a His tag at the N-terminus. |
| Names |
Dynein Light Chain 1 Cytoplasmic, 8 kDa Dynein Light Chain, DLC8, Dynein Light Chain LC8-Type 1, Protein Inhibitor of Neuronal Nitric Oxide Synthase, PIN, DYNLL1,DLC1, DNCL1, DNCLC1, HDLC1 |
| Accession # |
P63167 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 200mM NaCl, 1mM DTT, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKE FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
|
| Background |
Human Dynein Cytoplasmic Light Chain 1 (DYNLL1) has been identified as a protein that interacts with NOS1, leading to NOS1 inhibition. NOS1 dimer is destabilized after binding DYNLL1 a conformation necessary activity, and it regulate numerous biologic processes through its effects on nitric oxide synthase activity. DYNLL1 is widely expressed, with higher expression in testis and moderate expression in brain. |
