| Catalog# |
CG26 |
| Source |
E.coli |
| Description |
Recombinant Human Thioredoxin-Dependent Peroxide Reductase Mitochondrial/PRDX3 is produced with our E. coli expression system. The target protein is expressed with sequence (Pro63-Gln256) of Human PRDX3. |
| Names |
Thioredoxin-Dependent Peroxide Reductase Mitochondrial, Antioxidant Protein 1, AOP-1, HBC189, Peroxiredoxin III, Prx-III, Peroxiredoxin-3, Protein MER5 homolog, PRDX3, AOP1 |
| Accession # |
P30048 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVN CEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDP NGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ
|
| Background |
Thioredoxin-Dependent Peroxide Reductase Mitochondrial (PRDX3) is an enzyme that belongs to the AhpC/TSA family. Human and mouse PRDX3 genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Human PRDX3 protein has an antioxidant function and is localized in the mitochondrion. PRDX3 is involved in redox regulation of the cell. PRDX3 protects radical-sensitive enzymes from oxidative damage by a radical-generating system. It acts synergistically with MAP3K13 to regulate the activation of NF-kappa-B in the cytosol. |
