| Catalog# |
CD95 |
| Source |
Human Cells |
| Description |
Recombinant Human RTBDN is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser31-Pro229) of Human RTBDN fused with a polyhistidine tag at the C-terminus. |
| Names |
Retbindin, RTBDN |
| Accession # |
Q9BSG5 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,pH 8.0,20% glycerol,0.1M NaCl,1mM DTT |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQR ALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGT DLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGS GSGPVDHHHHHH*
|
| Background |
Human Retbindin is a 229 amino acid secreted protein that belongs to the folate receptor family. The gene that encodes retbindin exists as two alternatively spliced isoforms. Retbindin is first expressed in retina. It may play a role in binding retinoids and other carotenoids as it shares homology with;riboflavin binding proteins. RTBDN gene was first identified in a study of human eye tissues. |
