| Catalog# |
CI21 |
| Source |
HEK293 |
| Description |
Recombinant Human Prorelaxin H1/RLN1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Cys185) of Human RLN1 fused with a polyhistidine tag at the C-termin |
| Names |
Prorelaxin H1,Relaxin-1 |
| Accession # |
P04808 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MPRLFLFHLLEFCLLLNQFSRAVAAKWKDDVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQT PRPVAEIVPSFINKDTETIIIMLEFIANLPPELKAALSERQPSLPELQQYVPALKDSNLSFEEFK KLIRNRQSEAADSNPSELKYLGLDTHSQKKRRPYVALFEKCCLIGCTKRSLAKYCVDHHHHHH
|
| Background |
Prorelaxin H1, which is encoded by RLN1 gene, is a 185 aa. protein. it is a heterodimer of a B chain and an A chain linked by two disulfide bonds. This protein belongs to the insulin family, and usually expressed in prostate but not in placenta, decidua or ovary. Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. It may be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix. |
