| Catalog# |
CA06 |
| Source |
HEK293 |
| Description |
Recombinant Human Ribonuclease 3/RNASE3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg28-Ile160) of Human RNASE3 fused with a 6His tag at the C-terminus. |
| Names |
Eosinophil Cationic Protein, ECP, Ribonuclease 3, RNase 3, RNASE3, ECP, RNS3 |
| Accession # |
P12724 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mMDTT,10%Glycerol,pH7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHN RTLNNCHRSRFRVPLLHCDLINPGAQNISNCRYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLD TTIVDHHHHHH
|
| Background |
Ribonuclease 3 (RNASE3) is a basic protein that is localized to the eosinophil primary matrix and belongs to the pancreatic ribonuclease family. RNASE3 is released during degranulation of eosinophils. RNASE3 possesses a wide variety of biological activities. RNASE3 interacts with bacterial lipopolysaccharide (LPS) and lipoteichoic acid (LTA). RNASE3 exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also Gram-positive strains. It promotes E. coli outer membrane detachment, alteration of the overall cell shape and partial loss of cell content. |
