| Catalog# |
CE52 |
| Source |
E.coli |
| Description |
Recombinant Human Selenocysteine Lyase/SCLY is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Ala445) of Human SCLY fused with a 6His tag at the N-terminus. |
| Names |
Selenocysteine Lyase, hSCL, SCLY, SCL |
| Accession # |
Q96I15 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPE VIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSV VKHFHANQTSKGHTGGHHSPVKGAKPHFITSSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQT EVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAAGLPPILVHTDAAQALGK QRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTPMIAGL GKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFPGTQRLPNTCNFSIRGPRLQG HVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLK QAVAQLEDQA
|
| Background |
Selenocysteine Lyase belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. Selenocysteine Lyase exists as a homodimer in the cytosol. In the brain, Selenocysteine Lyase is as an enzyme that putatively salvages Sec and recycles the selenium for selenoprotein translation. Selenocysteine Lyase catalyzes the decomposition of L-selenocysteine to L-alanine and elemental selenium. Selenocysteine Lyase can be up-regulated In acute glomerulonephritis, it can also be regulated by JUN/AP-1. |
