| Catalog# |
C638 |
| Source |
HEK293 |
| Description |
Recombinant Human Semenogelin-1/SEMG1 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Thr402) of Human SEMG1 fused with a polyhistidine tag at the C-terminus. |
| Names |
Semenogelin-1, Semenogelin I, SGI, SEMG1, SEMG, Alpha-Inhibin-92, Alpha-Inhibin-31, Seminal Basic Protein |
| Accession # |
P04279 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Hac-NaAc, 150mM NaCl, pH 4.5 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLN ALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGK GISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKG HYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKA NKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESG QSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDQNPLFTVDHHHHHH
|
| Background |
Semenogelin-1 (SEMG1) is the predominant protein in semen; it is a secretory protein involved in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes SEMG1 into smaller peptides, each possibly having a separate function. In the proteolysis process, Alpha-inhibin-92 and alpha-inhibin-31 are produced; they inhibit the secretion of pituitary follicle-stimulating hormone. At the same time, it breaks down the gel matrix, allowing the spermatozoa to move more freely. |
