| Catalog# |
C639 |
| Source |
HEK293 |
| Description |
Recombinant Human Serpin Peptidase Inhibitor, Clade A, Member 6 /Serpin A6 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Met23-Val405) of Human Serpin A6 fused with a polyhistidine tag at the C-terminus. |
| Names |
Corticosteroid-Binding Globulin, CBG, Serpin A6, Transcortin, SERPINA6, CBG |
| Accession # |
P08185 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGTCGHTRA QLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLESFSADIKHYYE SEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTR EENFYVDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSR DTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVH KAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPVLDHHHHH H
|
| Background |
Serpin Peptidase Inhibitor, Clade A, Member 6 (SerpinA6) belongs to the Serine Protease Inhibitors superfamily. SerpinA6 is synthesized in liver and has also been identified in a number of glycocorticoid responsive cells. SerpinA6 has an alpha-globulin protein with corticosteroid-binding properties. It is the major transport protein for glucocorticoids and progestins in the blood of most vertebrates. Defects in SERPINA6 are a cause of corticosteroid-binding globulin deficiency which is an extremely rare hereditary disorder characterized by reduced corticosteroid-binding capacity with normal or low plasma corticosteroid-binding globulin concentration, and normal or low basal cortisol levels associated with hypo/hypertension and muscle fatigue. |
