| Catalog# | 
            CE54 | 
        
        
            | Source | 
            E.coli | 
        
        
            | Description | 
            Recombinant Human Serpin B6 is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Pro376) of Human SERPINB6 fused with a TraxA, His tag at the N-terminus. | 
        
        
            | Names | 
            Serpin B6, Cytoplasmic Antiproteinase, CAP, Peptidase Inhibitor 6, PI-6, Placental Thrombin Inhibitor, SERPINB6, PI6, PTI | 
        
        
            | Accession # | 
            P35237 | 
        
        
            | Formulation | 
            Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 | 
        
        
            | Shipping | 
            The product is shipped at ambient temperature. | 
        
        
            | Reconstitution | 
            Always centrifuge tubes before opening. Do not mix by vortex or pipetting. 
            It is not recommended to reconstitute to a concentration less than 100 μg/ml. 
            Dissolve the lyophilized protein in 1X PBS. 
            Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. 
            Reconstituted protein solution can be stored at 4-7°C for 2-7 days. 
            Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/μg (1 IEU/μg). | 
        
        
            | Amino Acid Sequence | 
            
             MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFHMDVLAEANGTFALNLLKTLGKDNSKNV FFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRVAN RLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDP LTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLP YVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLR NLGMTDAFELGKADFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCAD HPFLFFIQHSKTNGILFCGRFSSP 
             | 
        
        
            | Background | 
            Serpin B6 belongs to the serpin family. Serpin B6 localizes to the cytoplasm. Serpin B6 is expressed in many tissues, abundantly by mast cells in different tissues and mastocytoma lesions. Serpin B6 may be involved in the regulation of serine proteinases present in the brain or extravasated from the blood. In addition, Serpin B6 may play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss. |