| Catalog# |
C991 |
| Source |
HEK293 |
| Description |
Recombinant Human Serine/Threonine-Protein Kinase Sgk3/SGK3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu496) of Human SGK3 fused with a 6His tag at the C-terminus. |
| Names |
Serine/Threonine-Protein Kinase Sgk3, Cytokine-Independent Survival Kinase, Serum/Glucocorticoid-Regulated Kinase 3, Serum/Glucocorticoid-Regulated Kinase-Like, SGK3, CISK, SGKL |
| Accession # |
Q96BR1 |
| Shipping |
The product is shipped at ambient temperature. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQF PAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSE DEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQK KIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPE HRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTP EYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWS ILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTE ETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFLVDHHHHHH
|
| Background |
Serine/Threonine-Protein Kinase Sgk3 (SGK3) belongs to the Ser/Thr protein kinase family. Proteins of this family are involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival, and migration. SGK3 is expressed in most tissues, including the pancreas, liver, heart, lung, and skeletal muscle. SGK3 contains one AGC-kinase C-terminal domain, one protein kinase domain, and one PX (phox homology) domain. SGK3 plays a role in neutral amino acid transport and activation of potassium and chloride channels. |
