| Catalog# |
C281 |
| Source |
E.coli |
| Description |
Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein α/SGTA is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Glu313) of Human SGTA fused with a 6His tag at the N-terminus. |
| Names |
Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha, Alpha-SGT, Vpu-Binding Protein, UBP, SGTA, SGT, SGT1 |
| Accession # |
O43765 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MGSSHHHHHHSSGLVPRGSHMDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGV TVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAA VHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKH VEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSFDIAGLLNNPGFMSMASNLMNN PQIQQLMSGMISGGNNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIRSRTPS ASNDDQQE
|
| Background |
Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein α (SGTA) is an ubiquitously expressed protein which belongs to the SGT Family. SGTA contains three TPR Protein-Protein Interaction Duplicates. SGTA is a co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity. SGTA is capable of interacting with the major nonstructural protein of Parvovirus H-1 and 70-kDa heat shock cognate protein. It interacts with NS1 from Parvovirus H-1, with Vpu and Gag from HIV-1. It also interacts with SARS-CoV Accessory Protein 7a, DNAJC5 and DNAJC5B. However, its function is not known. Since this transcript is expressed ubiquitously in various tissues, SGTA may serve a housekeeping function. |
