| Catalog# | 
            CB01 | 
        
        
            | Source | 
            Human Cells | 
        
        
            | Description | 
            Recombinant Human Superoxide Dismutase [Mn] Mitochondrial/SOD2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys25-Lys222) of Human SOD2 fused with a polyhistidine tag at the C-terminus. | 
        
        
            | Names | 
            Superoxide Dismutase [Mn] Mitochondrial, SOD2 | 
        
        
            | Accession # | 
            P04179 | 
        
        
            | Shipping | 
            The product is shipped on dry ice/ice packs. | 
        
        
            | Storage | 
            Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
        
        
            | Purity | 
            Greater than 95% as determined by reducing SDS-PAGE. | 
        
        
            | Endotoxin | 
            Less than 0.1 ng/µg (1 IEU/µg). | 
        
        
            | Amino Acid Sequence | 
            
             KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALK FNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNK ERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMA CKKVDHHHHHH 
             | 
        
        
            | Background | 
            Superoxide Dismutase (SOD2) belongs to the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial matrix protein that forms a homotetramer and binds one manganese ion per subunit. SOD2 transforms toxic superoxide, a byproduct of the mitochondrial electron transport chain into hydrogen peroxide and diatomic oxygen. It is reported that oxidative stress plays an essential role in the development of breast cancer, while SOD2 is one of the primary enzymes that directly convert potential harmful oxidizing species to harmless metabolites. |